PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 620aa    MW: 68904.8 Da    PI: 7.0379
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015498.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.7e-093954321954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Aco015498.1 395 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 432
                  664459******************************88 PP

2BELL107.96.2e-35257326372
         BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   elqk+kakL s+leeVd+rY++y+eq+++v+ +Feavag g+a++Y slA+k++SrhFrcL+d i++qi
  Aco015498.1 257 LELQKRKAKLYSMLEEVDRRYRRYCEQMRAVVLAFEAVAGEGAAAVYSSLASKTMSRHFRCLRDGIVGQI 326
                  589*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-57191324IPR006563POX domain
PfamPF075262.7E-46197322IPR006563POX domain
PROSITE profilePS5007112.147373436IPR001356Homeobox domain
SMARTSM003897.0E-9376440IPR001356Homeobox domain
CDDcd000862.77E-11376437No hitNo description
SuperFamilySSF466892.95E-17377443IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-28379443IPR009057Homeodomain-like
PfamPF059208.2E-18393432IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MAHEYQHQQH HHHHHHHQPD FISATNNAAA ATAVALHGFG TNHELYDLQA GMEMLGIPSK  60
QPHAQNVADG SWKVFFPKAG SSSTIGFSQP STDAGLMGAP EPNMGTWPPQ SNRMAVVDQS  120
IRCLLPSEGG EQANRELSLS LCNADPSGSG FHYQVEDASL RKPEDSLHQQ EVFFFGPSAA  180
AASAPMASLY QQHPQQLKNS KYLLPAQELL NEFCSLGKEH GSSTLKRQSK ISKQWDEGGS  240
SSSSSPWTQP LHTLEILELQ KRKAKLYSML EEVDRRYRRY CEQMRAVVLA FEAVAGEGAA  300
AVYSSLASKT MSRHFRCLRD GIVGQISATR KAMGEKDPVA PGTTRGETPR LKLLDQCLRQ  360
QKAFQQPGGT MESHPWRPQR GLPERSVSIL RAWLFEHFLH PYPSDVDKHI LARQTGLSRS  420
QVSNWFINAR VRLWKPMVEE MYMEELKEQE NQSPRTTTTT IHEDNDHNNN HHHHHHLESN  480
PNPNPNPNPN PNLIEQKPTP VQLLHDSGSL ASIINSKGAA EPRVESFGFV DLDFASYGQC  540
GGHGARGGVS LTLGLQRHDN ASQAPTLLFP RSDHHHHQHI EENQQQASQF SINMDGAEGS  600
QHLPYRNLMG AQLLHDLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15382440563Homeobox protein Meis2
3k2a_B1e-15382440563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008807228.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_008807227.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-121BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLB9GKE50.0B9GKE5_POPTR; Uncharacterized protein
STRINGPOPTR_0001s09720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-103TALE family protein